SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154421060|ref|XP_001583544.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154421060|ref|XP_001583544.1|
Domain Number 1 Region: 18-248
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.94e-45
Family Protein kinases, catalytic subunit 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154421060|ref|XP_001583544.1|
Sequence length 280
Comment STE family protein kinase [Trichomonas vaginalis G3]
Sequence
MNDIDCDVMQSEGLAFKCVITTTKHGKVFLVEWLKYNQLFSLKRIERAHYEQNQINIIRN
LYHFNIINVYKTFMREKYVYLLMDYCPLDIQRYIEQRGVLSESRFAEAAYSMLKSVSLMH
SKRICHNNIRPSKFLLDKYGRVQISDFCNAAQYQENEESKFEHAQSVDSWSLGVTFYYML
TGRLITDLYFSEEEAMSKDFSHIKYPEVSKECIRLISSCLNNNEKARPSVDELLSSPLFN
PFRPVKMSASKQTAFSANTSLRAIPVIVKPVLTKVVKTSI
Download sequence
Identical sequences A2DAQ5
XP_001583544.1.43485 gi|121917786|gb|EAY22558.1| gi|154421060|ref|XP_001583544.1| 5722.A2DAQ5 81529.m00379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]