SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156083479|ref|XP_001609223.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|156083479|ref|XP_001609223.1|
Domain Number - Region: 99-142
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000392
Family DNA repair protein Rad51, N-terminal domain 0.061
Further Details:      
 
Domain Number - Region: 42-72
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00445
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156083479|ref|XP_001609223.1|
Sequence length 175
Comment hypothetical protein [Babesia bovis T2Bo]
Sequence
MVECQMLEIQDDQNTLARSAIAELRKQQPQKPEAQELQHELVEEIYERIYEAICQKQPKN
IVQFIVDFLCEHYPEHLHSYSKLLKAEPELEANRMKVLQFFNYYHLPVEVGWHFTNAGFD
TLDTILTLNKDSLAEIESYSEAQWLPGHKVRLYAMFDDIKKYVEEFKRESSVYTI
Download sequence
Identical sequences A7AV29
gi|154796474|gb|EDO05655.1| gi|156083479|ref|XP_001609223.1| gi|156083479|ref|XP_001609223.1| XP_001609223.1.62033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]