SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156088231|ref|XP_001611522.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156088231|ref|XP_001611522.1|
Domain Number 1 Region: 63-193
Classification Level Classification E-value
Superfamily MTH1598-like 2.09e-26
Family MTH1598-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156088231|ref|XP_001611522.1|
Sequence length 243
Comment hypothetical protein [Babesia bovis T2Bo]
Sequence
MESEDKYIIDGVEIRSKPCRSRRRGHNPEATGAQTLSIPDITPPDTPGSDIESEVKELEL
DHHDYKYLDHPADVILTSHGTGIASALESLVIAMFGYMTDLSLVEPKKRKRIKVVTNSLP
RLIFSILDQCLYLNSAYRFLVKYVRINNGIDVHKLLKGDVNVEVEVALYGDTFDHDVHTQ
GTEIKAATYHGLRAEIMIGPHKIIISDEPLYQQYRDELPAVLEELSSDDFAKADFKLYAL
VDI
Download sequence
Identical sequences A7AN20
gi|154798776|gb|EDO07954.1| gi|156088231|ref|XP_001611522.1| gi|156088231|ref|XP_001611522.1| XP_001611522.1.62033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]