SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156089031|ref|XP_001611922.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156089031|ref|XP_001611922.1|
Domain Number 1 Region: 149-198
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000311
Family Tudor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156089031|ref|XP_001611922.1|
Sequence length 321
Comment hypothetical protein [Babesia bovis T2Bo]
Sequence
MENQESYEDLQAKLADYRNKLQLIQEALQQTPGDDELKALESDLKEVIQLTQDLIQYKKQ
NEQGDIFPSSGIASPQPADATSDIGGNDSFLGRICVVLYNGKRKYGEIIQVMGNLPSDQV
IIQLVGTGEQCSLAAKDLKLIDPPSSEECKVGSLVQVLYADDGRWYDAVVNRETETGYVI
TYKDYNISEEVRRDWVRMRLRADAKAKEVKEIITPAGYKIPENLIIKQGDSEKEKLRKKK
LVQTLKKQQKAERVESEASQRANSWRKFQQKAGAKNKSGYMTGKREGSIFSSTDESTERL
APNILHNSFIPRKKFDFNERF
Download sequence
Identical sequences A7AP70
gi|156089031|ref|XP_001611922.1| gi|154799176|gb|EDO08354.1| gi|156089031|ref|XP_001611922.1| XP_001611922.1.62033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]