SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156089337|ref|XP_001612075.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|156089337|ref|XP_001612075.1|
Domain Number - Region: 168-205
Classification Level Classification E-value
Superfamily UBA-like 0.0527
Family UBA domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156089337|ref|XP_001612075.1|
Sequence length 207
Comment NAC domain containing protein [Babesia bovis]
Sequence
MAKDRVDSLLADQVDDSEDEVSSEGDSDIEESKGADGSSSKGRQNKNERKSRKLLGKLGL
KPVEGITKVCIKKSKQVFFVVNKPDVYKLPNSDTYIIFGEAKVEDMGQNSALEAAQRLSQ
LSAALQAADAAKGGISDSGERPSDSPDDNMKVDDDVEHVCGLSDSDGVNSSDIDLVVSQV
GCTREQAKVALIKNKGDIVETILDLST
Download sequence
Identical sequences A7APM3
gi|156089337|ref|XP_001612075.1| XP_001612075.1.62033 gi|154799329|gb|EDO08507.1| gi|156089337|ref|XP_001612075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]