SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156095484|ref|XP_001613777.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156095484|ref|XP_001613777.1|
Domain Number 1 Region: 40-73
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000139
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156095484|ref|XP_001613777.1|
Sequence length 279
Comment hypothetical protein [Plasmodium vivax SaI-1]
Sequence
MTRHSKNNTANPIFTYHERKKVSDVGTLKERLGKDSMRRFEQCWICLRNAETPVSTPYGH
IFCKICIVNHFLTQKKTYAKRKKEYDEQVKELKRRKDEEASYQVEREKRKFMQELEKIDN
SEHVQVILHSLEGKEEQKNLLDISNNFWLASNSKVKKDLSKKKLTRPSKILSCPVSGKEL
KMGDLIAINPEVSQGGDVPGGEESWICSYSKKNIHHQRAVLIKKTGQIIIKSIFEKFIYG
KNALEVTVGDGDFIDLQPGGTAFCSHSNVEKTMYRESLL
Download sequence
Identical sequences A0A0J9STR4 A0A0J9WDL7 A5K9H8
gi|156095484|ref|XP_001613777.1| 5855.PVX_080345 gb|PVX_080345 XP_001613777.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]