SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156095933|ref|XP_001614001.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156095933|ref|XP_001614001.1|
Domain Number 1 Region: 529-618
Classification Level Classification E-value
Superfamily HemD-like 0.0000222
Family HemD-like 0.029
Further Details:      
 
Weak hits

Sequence:  gi|156095933|ref|XP_001614001.1|
Domain Number - Region: 164-208
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000667
Family DNA repair protein Rad51, N-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156095933|ref|XP_001614001.1|
Sequence length 709
Comment hypothetical protein [Plasmodium vivax SaI-1]
Sequence
MTQIGSPQKDPHLNTVIRPPLKIAQGGKDKRGGVPFLVSSKNGDIQKNSEDGKKKTGHLE
QCQEQEVIQEQEVFQERVGVPPRDEREKYNEFFEAKMYLPPLRASKRELNFFFKILSNAM
EKNNKSNIYISLMDILCKNFPSYIGLFAHLWFQCKVLLAEKLILIEFFRQLKINSEIINH
FFNYGYDSFETILSITPQDLANVQEFNKVTWLPGHTFRLKMIFSQIEKYFNLFIQQNDDY
VQKIKKFILSKRRRTELTLQLSLERQQNDRGQCPMYGPHVGNNTNLPLPPEGTQDVNIIT
YQQYVSDSPGKPLCLNKFENYEQVRKKNSPFSLNLKCVQGVGRNKTGEPPRGVKSKVSIL
ITSPEGAKIYRFVAILLIYNLVKREAEGESSLEGIHHVDHDAIKEVLNFPIVSIGKSCNA
VLNNDGTRRDLSEMFQSVVKEFPKCKINQQEFHQLNKSVKNLNIVFTPSKANSVTLHREL
TAHLAKHKGEGPLNAENIIWVASSISESNFDHKKSEFTPLGKKREEEKNRLTITRINCYD
TKKVTYNKNQIEIRRNSIICLMSNSTVASFFQNFGNDFAATLCMGRNSSMLAKKLNFKQV
LYPEDSKMESFLIMLIKLHNELGERFGTQHDVVLTRERGKNGQLGRALTEQRIPYRVVPC
IRTHYHGQGIRSLYSILSSQVYGKKKRGGVNNSPRHPSLQNIARTNRHT
Download sequence
Identical sequences A0A0J9S407 A0A0J9TN41 A5K8X8
gb|PVX_101270 gi|156095933|ref|XP_001614001.1| XP_001614001.1.43797 5855.PVX_101270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]