SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156096889|ref|XP_001614478.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156096889|ref|XP_001614478.1|
Domain Number 1 Region: 162-208
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000376
Family Tudor domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|156096889|ref|XP_001614478.1|
Domain Number - Region: 2-35
Classification Level Classification E-value
Superfamily Prefoldin 0.0602
Family Prefoldin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156096889|ref|XP_001614478.1|
Sequence length 316
Comment hypothetical protein [Plasmodium vivax SaI-1]
Sequence
MEEFNETLEGLEGKIAEYEKQLALVREEIKKYEETSGEEDEQIKNLRKLECDMLEVINLT
LDLINYKKQNEAEGDALEPSLEKEPAEEANQDATNEASAVIGRTCSFIYESKKVYGLIQN
VVKENGTEQLLINIFENNEQIMIPPKYVLMNEVLTESALAENTQFQALYKKDGLWYDCIV
SKSKGDTFLVNYIGYNTSEYVKNDQVRIKKKKKVKEIVTPAGYKIPENLIVKENDSLKVQ
MRKKKKRIALKKKQKSELINKEYTNKTQQWRSFHEKAVSKSKHLLVAHKKVENIEYKNAP
SSFTIRRKFDCHDNED
Download sequence
Identical sequences A0A0J9SG41 A0A0J9SVZ8 A0A0J9TFC2 A0A1K9Y8T9 A5K7J2
5855.PVX_095050 gb|PVX_095050 gi|156096889|ref|XP_001614478.1| XP_001614478.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]