SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156097160|ref|XP_001614613.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|156097160|ref|XP_001614613.1|
Domain Number - Region: 98-144
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000765
Family NusA extra C-terminal domains 0.038
Further Details:      
 
Domain Number - Region: 10-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156097160|ref|XP_001614613.1|
Sequence length 255
Comment hypothetical protein [Plasmodium vivax SaI-1]
Sequence
MMPENCSRKSVSRLFDCLSKEIEKQQPKNVIHFMVDFLCKNYGSHLRGFAHVWDVGGRPN
CGKTFKHRKKEKCVFFFFLFSIFSLWTCFSDLELEKEKKLVIEFFKSQKLTTEIAKHFIS
VGFDSMESLLYLNAHVLDDIEKFNNVNWLPGHKIRLQVGESAVDSAKELPPGTMLRGVCA
SIGGIIPRIFPPFLIPPFTIPYPPTQQMFSNIQENIKTFYAEYDKDDVKCGLDYSALRVS
PGRQKRKEKKKKRKL
Download sequence
Identical sequences A0A0J9SEH7 A0A0J9SXM1 A0A0J9TWX7 A0A0J9W1D4 A5K6E5
gb|PVX_098820 5855.PVX_098820 XP_001614613.1.43797 gi|156097160|ref|XP_001614613.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]