SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156097941|ref|XP_001615003.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156097941|ref|XP_001615003.1|
Domain Number 1 Region: 109-345
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.46e-54
Family RecA protein-like (ATPase-domain) 0.000000126
Further Details:      
 
Domain Number 2 Region: 26-88
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000000000000753
Family DNA repair protein Rad51, N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156097941|ref|XP_001615003.1|
Sequence length 347
Comment meiotic recombination protein DMC1-like protein [Plasmodium vivax SaI-1]
Sequence
MATLPSSKSTSKVAATTEMEEEVTKEHQFQEIEKLQDLGINAADINKLKGSGYCTILSLI
QTTKKELCNVKGISEAKVEKILEVASKIENCSGFITAHQLVHKRSKVLKITTGSSTLDKT
LGGGIESMSITELFGENRCGKTQICHTLAVSAQLPRSVGGGNGKVCYIDTEGTFRPEKIC
KIAERYGIDGEDVLDNILYARAFTHEHLYQLLAVSAAKMCEEPFALLVVDSIISLFRVDF
SGRGELSERQQKLNKTMSILSKLGEQFNIAVLITNQVMSDPGATMTFIANPMKPVGGHVI
GHASTTRLSLRKGKGDQRVCKVYDAPNLPEVDCIFQLSDGGVIDATD
Download sequence
Identical sequences A0A0J9SFU4 A0A0J9SZ59 A0A0J9TG71 A0A0J9TZ77 A0A1G4H8W6 A5K5U1
gi|156097941|ref|XP_001615003.1| 5855.PVX_089570 XP_001615003.1.43797 gb|PVX_089570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]