SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156098342|ref|XP_001615203.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156098342|ref|XP_001615203.1|
Domain Number 1 Region: 111-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.89e-58
Family RecA protein-like (ATPase-domain) 0.0000000216
Further Details:      
 
Domain Number 2 Region: 41-96
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000675
Family DNA repair protein Rad51, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156098342|ref|XP_001615203.1|
Sequence length 350
Comment DNA repair protein RAD51 [Plasmodium vivax SaI-1]
Sequence
MKPANTREDATHKFSNNNAVDEIEEEHLYSGPLKIEQLLAKGFVKRDLELLKEGGLQTVE
CVAYAPMRTLCAIKGISEQKAEKLKKACKELCNSGFCNAIDYHDARQNLIKFTTGSKQLD
SLLKGGIETGGITELFGEFRTGKSQLCHTLAITCQLPIEQSGGEGKCLWIDTEGTFRPER
IVAIAKRYGLHPTDCLNNIAYAKAYNCDHQTELLIDASAMMADARFALLIVDSATALYRS
EYIGRGELASRQSHLCRFLRGLQRIADIYGVAVIITNQVVAKVDAMSMFGGHEKIPIGGN
IIAHASQTRLYLRKGRGESRICKIYDSPVLPEGEAVFAITEGGIADYEEK
Download sequence
Identical sequences A0A0J9SM17 A0A0J9T8V3 A0A0J9V3J7 A0A0J9WDZ5 A0A1G4GX48 A5K498
XP_001615203.1.43797 gi|156098342|ref|XP_001615203.1| gb|PVX_091045 5855.PVX_091045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]