SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156098927|ref|XP_001615478.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156098927|ref|XP_001615478.1|
Domain Number 1 Region: 3-140
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 3.53e-23
Family Staphylococcal nuclease 0.013
Further Details:      
 
Domain Number 2 Region: 641-689,731-819
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.44e-16
Family Staphylococcal nuclease 0.0046
Further Details:      
 
Domain Number 3 Region: 864-963
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.08e-16
Family Tudor domain 0.0078
Further Details:      
 
Domain Number 4 Region: 386-471,561-612
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000101
Family Staphylococcal nuclease 0.01
Further Details:      
 
Domain Number 5 Region: 916-1065
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000353
Family Staphylococcal nuclease 0.0037
Further Details:      
 
Domain Number 6 Region: 165-187,259-378
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000106
Family Staphylococcal nuclease 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156098927|ref|XP_001615478.1|
Sequence length 1068
Comment hypothetical protein [Plasmodium vivax SaI-1]
Sequence
MERLNGIVKQVVSADTYVLAGAKKGGVAQERQVSLACIQCPRLFMKSQNVEKSEEAFAWE
SREFIRKMIIGKNVSFVVEYVYNNRTYCSVFYEEQNLSVLLLERGYANLVSNKNVKTNVY
ADLESYYVEAKEKKLGIFGSNVNSYVRNIVYSYNDKNQNKKIFELFSNRKLQCVVEHVRD
GSNFRVYAEVEASDKREVGISTPGGTSTSLQNGTVGESLSGGKGKKKKKGASGKKNPKNK
DGAEDSDGDDVAKATAGGYKTMYYFSFTLCGIIVDMFKKEVVNNVENVKEEQYAMETKKF
VEARLLNRDIEIVIKHIDNNCNLYANVFYKLGNICTLLLKNGYAYINDYTIKYVENAIDY
KRALDEAIQQRKKKWVNYTEKKVDYEKEYLATVIEVLYGDVIIVDYHNEERRLYMASIKC
EKHSTDLALNTLCLSAKDYLKSQITGEVVKIVTEYVRTPQSNSEGYIPQCSDDKGRMHFV
SVYKMENKKKKESAKGGAALPSSKWGGEGDEKKKKKKNAKKGGATTTGESNSVGKKKGIQ
MNGHAGTHAETHAGDENGEEDDQTVTNMNEQLVARGLAKVMNHRQEDEKASNYFKLQELE
KEAEEKKVGRFNPHLDIIKINNISGSENSLRARSFENVLNKYNNLNASVDYIYGANKFKL
HIPSQNLLINFILLGISVQKINLKEIGSMNTSAVQVKKLSAGGGEYDGEDAHNLVNGDGK
PNRKEKLELKEIAIQAYKYTRKMLMQRNVQITILTCDKGGNFIGILRHQNKDFGVHLLSL
GYGMLNEIGLSNTNERNNYVKAVEEAKKEKRNIWAIEKIDANEDDADNVLLNGQKNLSQF
DNIYYCSYVEDINNISIQLKSKQEQLKKLQDELNKPANLESSSQYVLSEIKKNTLVIAKY
IDKCYYRAVILQINKAKKKALVKYIDFGNEDELNFEDIRKLSDGLSLKSYPPFSIRVSLA
GVKIPAENKSDLIIYVKKFLLDKFLYVKFEKKERNGAYYHVVFYDYEQFTTNKNVKSVNE
DIVSSGICYVDNRSDTKIFEKLKKEEVVAKKAKLVIWAYGDIDYDDES
Download sequence
Identical sequences A5K523
gb|PVX_092430 5855.PVX_092430 gi|156098927|ref|XP_001615478.1| XP_001615478.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]