SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156101836|ref|XP_001616611.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|156101836|ref|XP_001616611.1|
Domain Number - Region: 569-608
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00518
Family DNA repair protein Rad51, N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156101836|ref|XP_001616611.1|
Sequence length 908
Comment hypothetical protein [Plasmodium vivax SaI-1]
Sequence
MRLITVGFLFLSTSFHYSHVFAANGNRNLNIKPTCHKSGKNDKANGSDNIANKGGAQHAA
NGATGTPSGSSNGKKGATTTSASAGQAGASGGMAAPGMNPNFEQMMKPLNDMFKGNGEGL
NIENIMNSDMFQNFFNSLMGGNPHDGAGGGQEILFKDMLNAMNAQGGGAPGAAATSGGAN
KDPNISVSPEQLNKINQLKDKLENVLKNVGVDVEQLKENMQNENIMQNKDALRDLLANLP
MNPGMMQNMMAGKDGNMFNMDPNQMMNMFNQLSQGKMNMKDFGMGDFMPPPVHANDQDAE
DDSRGKAFVTNSSNNDINFAHKLNAFEYSNGPSEGMFQLYGMNNDDGVIDDGMSDSVGKN
SALDVSGGSINRNLSDGDSAKEDSDESNANATSNSNATVPNKGGHEGGSANEVYSNEEEL
ITSSGSKGDANKLAGTGGYKNNNAFLDLNNLKKDASAAKYGKDNSGDKSNGGNSNGGNNK
VMNKRIGGKKKKTFKKKKNPGQIPFKMETLQKLVKEYTNTSNQKIMEKIIKKYVSMSNQS
ARGNSEEEDDEEEAEDEKSAKDKNSEKEAELNMNEFSVKDIKKLISEGILTYEDLTEEEL
KKLAKPDDMFYELSPYANEEKDLSLNETSGVSNEQLNAFLRKNGSYHMSYDSKAIDYLKQ
KKAEKKEEEQEDDNFYDAYKQIKNSYEGIPSNYYHDAPQLIGENYVFTSVYDKKKELIDF
LKRSNGATDSSNSSAGKDKGNSAESGTYKSKYYDKYMKKLSEYRRREAFKILKKRRAQEK
KMQKKQEMQNNSSNEVDYSEYFKKNGFINSSNGTVKTFSKDQLDNMVKQFNSDGDDIPSS
SGAGADLGDNYSGVSGGGQFSPSGGSGNNPSGYVTFDGQNIVGPNENEEEEPTEDVLNED
DDNADDDD
Download sequence
Identical sequences A5K0N7
XP_001616611.1.43797 gi|156101836|ref|XP_001616611.1| gb|PVX_084720 5855.PVX_084720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]