SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156101984|ref|XP_001616685.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156101984|ref|XP_001616685.1|
Domain Number 1 Region: 112-250
Classification Level Classification E-value
Superfamily MTH1598-like 1.16e-44
Family MTH1598-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156101984|ref|XP_001616685.1|
Sequence length 250
Comment hypothetical protein [Plasmodium vivax SaI-1]
Sequence
MKQPSSNEIVSLPQRGRRRVGRDSASSDGVESEDNGEQSGYDSAEEAGDSGKSGSSVHIE
GSYKSGSSIHIEGSYKSGSSVHIDCSDEASAQNVALPYAKKKIKDGRLEKTYHYEYLDHP
ADVILHSYGKTLRECFESACVSMFNYMCNLNKVETKISRHITARGGTLEDLLYNFLTECH
FLYGSEYIICKAVDILVFDQGSFFIEASAYGDVFSPDLHECGTEIKAITKHELRICFTED
LWEAFVLVDI
Download sequence
Identical sequences A0A0J9S785 A0A0J9T689 A0A0J9VC38 A0A1G4HIY3 A5K0W1
gi|156101984|ref|XP_001616685.1| XP_001616685.1.43797 5855.PVX_085095 gb|PVX_085095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]