SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157871568|ref|XP_001684333.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157871568|ref|XP_001684333.1|
Domain Number 1 Region: 138-373
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.16e-56
Family RecA protein-like (ATPase-domain) 0.0000000164
Further Details:      
 
Domain Number 2 Region: 58-122
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000000000119
Family DNA repair protein Rad51, N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157871568|ref|XP_001684333.1|
Sequence length 377
Comment RAD51 protein [Leishmania major strain Friedlin]
Sequence
MQTRSKAKGRRGRPSARPSEEVEVVESQPQEVLQNEEQEPQQQQQQQSTDMAEPNASGFR
VIQILENYGVASSDIKKLMECGFYTVESAAYAPKKAILAVKGISENKAEKIMAECAKLVP
MGFTSAVAYHEARKEIIMVTTGSREVDKLLGGGIETGSITELFGEFRTGKTQLCHTLCVT
CQLPISQGGAEGMALYIDTEGTFRPERLVAVAERYKLDPEDVLANVACARAFNTDHQQQL
LLQASAMMAENRFALIIVDSATALYRTDYSGRNELAARQMHLGKFLRSLHNLAEEYGVAV
VVTNQVVANVDGSAQMFQADSKKPIGGHIMAHASTTRLSLRKGRGEQRIIKVYDSPCLAE
AEAIFGIYDDGVGDARD
Download sequence
Identical sequences O61127
XP_001684333.1.98313 gi|157871568|ref|XP_001684333.1| gi|68127402|emb|CAJ05032.1| psu|LmjF28.0550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]