SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159119566|ref|XP_001710001.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159119566|ref|XP_001710001.1|
Domain Number 1 Region: 128-365
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.31e-60
Family RecA protein-like (ATPase-domain) 0.000000106
Further Details:      
 
Domain Number 2 Region: 50-111
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000408
Family DNA repair protein Rad51, N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159119566|ref|XP_001710001.1|
Sequence length 368
Comment Dmc1b [Giardia lamblia ATCC 50803]
Sequence
MPPRKAAEVSESDVTEGTEATDVVDAASAGTEEATEGDLTMADVTQTKHIVSPIDDLTKS
GIATMDIKRLKEAGIHTIQSLLMHTKKALGNVKGISEAKVDKILSVATEMCGKTFITGSE
ALKKRQQVKRLSTGCADFNALLGGGVETMSITEVFGEFRTGKTQLCHTLAVTAQLPVSKG
GGGGKTVYIDTEGTFRPEKVAPIAERFGLNPKKALDNIMVARVYTHEQQIECITALPKLM
VENQFSLVIVDSLTALFRVDFTGRGELADRQQKLGQHLSGLAKLADEFNLAVFVTNQVMA
QVDGAAMFTADPKKPIGGHILAHASTTRLYLRKGRGDTRVAKIYDSPSLAEGEASYSIAA
EGIIDAAE
Download sequence
Identical sequences E2RTP7 Q86C21
XP_001710001.1.56740 gi|157438119|gb|EDO82327.1| gi|159119566|ref|XP_001710001.1| GilaA.00349.a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]