SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|165895671|gb|EDR23307.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|165895671|gb|EDR23307.1|
Domain Number 1 Region: 22-161
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000000000144
Family Staphylococcal nuclease 0.0087
Further Details:      
 
Domain Number 2 Region: 516-600
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000369
Family Tudor domain 0.015
Further Details:      
 
Weak hits

Sequence:  gi|165895671|gb|EDR23307.1|
Domain Number - Region: 334-437
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000366
Family Staphylococcal nuclease 0.019
Further Details:      
 
Domain Number - Region: 205-297
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000798
Family Staphylococcal nuclease 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|165895671|gb|EDR23307.1|
Sequence length 678
Comment hypothetical protein, conserved [Entamoeba dispar SAW760]
Sequence
MTKVAMKRPENVFFNEKEISELKGKTVHGHIKRVEAPSHYIIEDNNRRRFKAVLYGVNQM
LRFNTEKGKFEFDEDAEEAMKYINRYFNQRDVTVKVIETTSRFVYAEVSVEKKDIAEELL
KSGFVVCNKLETATEEIKQKYQAAEKEAKKEKKARWTEFDQAAEDALIAKRQQRLKELED
RKKNAKVISGAEIISIGNHIKAKKGTEVYDIHLASVRPVFKKNNKEFNDLVQFRIKECLR
KLLVGKKFEAKECYRRSFTKEEKTIEEIFYDVYASGKNVAVTLIKEGLVLLEKSHDEFYQ
SFDYKLLTETPKGEYKEKAVTQYPPEKRESIKDVFLNNSFNCIVERVINVCKYIIYIPEK
DCRMTVFLSHCRIPRDDENEELKKFNEESKAAVRSLFGLNEVTVDFREFFKGNFSVDILT
KKFDLCDVVLGKAYAQFAGRDIPENIAELKENQEGIYKFVGAKKDGETKPQPVRPVKVVK
EVHREIKFGEGKNVYITGFDGSMIYYYEKAADAKFIDELSNKLKKCSKGSVEQKDGQKCI
VEIKGVQYRAIITKAVPTANVVKCIDTGVVIVCGKNKLKPLKEEEEKIEVTVKSIALAGI
KTLVRGKDVDFDSMVAAVSAFFNKEATINPFLMIFVSXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXKLIWLMKT
Download sequence
Identical sequences B0EQ84
gi|165895671|gb|EDR23307.1| gi|167392749|ref|XP_001733502.1| XP_001733502.1.18373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]