SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|165896178|gb|EDR23671.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|165896178|gb|EDR23671.1|
Domain Number 1 Region: 12-129
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.98e-21
Family Ricin B-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|165896178|gb|EDR23671.1|
Sequence length 129
Comment hypothetical protein EDI_297140 [Entamoeba dispar SAW760]
Sequence
MANEARTLVTPEGNVVDIQGASQENGANAIIYPRHGGENQLFFIDKQIGWIISVFSRKAL
TVKENMHDIIQSDYCSLSRQQWIFEDNPDGTTIIRCYENPELVLSVTNNIDKVCLSPFTR
EAHQLWRIE
Download sequence
Identical sequences B0EP75
jCVI|EDI_297140 XP_001739935.1.18373 gi|165896178|gb|EDR23671.1| gi|167391888|ref|XP_001739935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]