SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167389781|ref|XP_001739081.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167389781|ref|XP_001739081.1|
Domain Number 1 Region: 22-152
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000000536
Family Staphylococcal nuclease 0.01
Further Details:      
 
Domain Number 2 Region: 175-311
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000000811
Family Staphylococcal nuclease 0.0074
Further Details:      
 
Domain Number 3 Region: 740-837
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000000017
Family Staphylococcal nuclease 0.0044
Further Details:      
 
Domain Number 4 Region: 660-747
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000732
Family Tudor domain 0.013
Further Details:      
 
Domain Number 5 Region: 485-593
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000109
Family Staphylococcal nuclease 0.016
Further Details:      
 
Domain Number 6 Region: 353-450
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000405
Family Staphylococcal nuclease 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167389781|ref|XP_001739081.1|
Sequence length 843
Comment hypothetical protein [Entamoeba dispar SAW760]
Sequence
MPAQANKKGVSKKVDASDKKVFMNAIVTGITDKNGLVLATKKEEEKNPIVVIAYLELPRF
DKKQNKEETFAYECGELLRKKLVNGKEVKFEVISEATDNIPKMVIPFVNGENIALTLLEN
GYGILKGKGKEIDEYTNAENKAKRDKKGVYCDTPEKVSIKKPTDPKLTTKELDFYVNKSL
NGHIKKVDAPGQFIVETPERKIVRVSLFGINQHAPFNVEKKQFEFDDIAKEAIKFNNKNY
NQRDCVVKIMDNGKRVTGIITVDKKDIAEELLKNGYVTVSTFEENTESVKKVYEEREALA
KKERKGRFVNFDQAAEDAAKAKKEKREKDLKERKKNARVIRGANILFIGKYLRIEKDGEI
LNVKFASIKPLYKKDDKAFNELIEFRMREVIRKLIVGKKFECKEAYKSENKKGEETITEV
YYDVYADKTNVAIPLLKEGLVVVDERVKDQFYQSFDYSQLKAVPKKTYKPVPITNYSNLD
NVKDMLIGNNFKCIIEKAISLTVYLIYIPEKNSQLIVHLQNCFVPKDDSNDNLKKFVDNA
KTNVKQLCEYREVLVEFKRYNKGNLYVEILNNGTDLAHYILEHGFAIPTGRYNISSEIEQ
MKENMTQIYQFDTQKKKEVTEVVEKKPKRITEIKFSAEQKVYLTGFDGEKIGYYDNAEDA
KIIEEVNTMCKTVKKGAMKPAVGDKCIVESKGFFYRAEFVEVATGANVLKCIDTGAVIIC
GKNKLKPITEEIAGKPVTVKTVGLVGLKTLTTKDVDFSAAVEAVASYYKKEVSLFVSGEE
AKVVVEGVCINTYLVQHGLAFVDKHFHDNSEWGVALLAAQSQAKENHLNVWRYGEVADEE
EKN
Download sequence
Identical sequences B0ELP5
jCVI|EDI_231780 gi|165897359|gb|EDR24545.1| gi|167389781|ref|XP_001739081.1| XP_001739081.1.18373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]