SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167393189|ref|XP_001740461.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167393189|ref|XP_001740461.1|
Domain Number 1 Region: 37-106
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000996
Family RING finger domain, C3HC4 0.048
Further Details:      
 
Domain Number 2 Region: 124-180
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000023
Family IBR domain 0.01
Further Details:      
 
Domain Number 3 Region: 192-244
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000601
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167393189|ref|XP_001740461.1|
Sequence length 265
Comment protein ariadne-1 [Entamoeba dispar SAW760]
Sequence
MIKTNEKEIEENIIQSLELIRSYLSFEDSLNNIFNKPKTEDCPICYETREVELMYSIEPC
NHRFCLCCLIEHVKQKVENGEWEIKCPEQECQTIIPLSTLISDGLIQESKVLSQLEMNGV
NANLRSDSHTRYCPKCGCAIVGTRRKPRIVCPQCSFVYCYNCKEEYHEGYSCAQYQQWKI
DNGKGDEEFKKYISTHCTCCPKCKIPVERIKGCNFIRCDLKKGGCGCGFCYACGKEVSHH
SAHILKRDCSLSGEELPKVVKKLRL
Download sequence
Identical sequences B0EQS6
XP_001740461.1.18373 jCVI|EDI_196650 gi|165895430|gb|EDR23122.1| gi|167393189|ref|XP_001740461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]