SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169800353|gb|EAL49542.2| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169800353|gb|EAL49542.2|
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily MTH1598-like 2.88e-41
Family MTH1598-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169800353|gb|EAL49542.2|
Sequence length 143
Comment hypothetical protein, conserved [Entamoeba histolytica HM-1:IMSS]
Sequence
MSFEYLDHPADVILHSWGQNIIEAFENAAAGMFNFMSDLTKVEEKEIKKISIDATSYEEA
LVKFLDSWLCIFSSELFIGKSFKCEVFDDNDEENIHIECKGIGEYFVIGKHQQGTEIKAI
TWHNLEIYDDEKDQTHIHILLDI
Download sequence
Identical sequences A0A175K0S5 C4MB82 M2Q102 M7WB57 N9UWG7
jCVI|EHI_028560 294381.C4MB82 gi|169800353|gb|EAL49542.2| gi|183235784|ref|XP_654928.2| XP_654928.2.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]