SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169802410|gb|EAL49442.2| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|169802410|gb|EAL49442.2|
Domain Number - Region: 114-210
Classification Level Classification E-value
Superfamily MTH1598-like 0.0366
Family MTH1598-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169802410|gb|EAL49442.2|
Sequence length 278
Comment hypothetical protein EHI_010330 [Entamoeba histolytica HM-1:IMSS]
Sequence
MIIVVIFGTVLIVTCINKPKQKLREYGKVESNTSLRPELTFNEMCQKINTLHAKPIIKTS
IGIDVPRLATKIIIKKSDKIILSGAEIFNKYEKEKYSAELTVREVVSKMIELFDGNDMKE
YFEHTFEDLFNYIRTKTEGDVSSCFKKLLPIVFPEDCLTISVMKTFTQALFAAAVEYLLP
FRRKHQYHDGYTGWNIEVIIESQEINIKHTKGETSYEENGFNFEWCLIYKIDRINKRIIS
LDLQIDNVQFNNYPNDLREDFIICIDKINAESHLKELN
Download sequence
Identical sequences C4LYT0 M2Q1J4 N9USP3
jCVI|EHI_010330 gi|169802410|gb|EAL49442.2| gi|183231580|ref|XP_654828.2| XP_654828.2.49425 294381.C4LYT0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]