SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183234737|ref|XP_650398.2| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183234737|ref|XP_650398.2|
Domain Number 1 Region: 171-218
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000146
Family RING finger domain, C3HC4 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|183234737|ref|XP_650398.2|
Sequence length 240
Comment hypothetical protein [Entamoeba histolytica HM-1:IMSS]
Sequence
MGITQSIPFEEQIPNTPPTEMEENQPDVPLVNAQIKHVVLYCIDKMTLHVSNGFLHFLID
CAIEAHLEAYTMVEGQKKILETKELPAQMQQEVSIPNISNILALTIDITKSVNANIPLTE
YILIDSISVTILLTSEVPKISSQQFHIGDVTYNSFDVFGVDSDDVTGTDNLCVICTTDPR
EILLLPCRHITMCAGCYEEVKERTHQCPICRTPITAAINFSRKSVTPKDDATEIEIVDTK
Download sequence
Identical sequences A0A175JY22 C4M9D6 M2RUZ6 M3UPP0 N9UPP1
294381.C4M9D6 XP_650398.2.49425 gi|169800933|gb|EAL45012.2| gi|183234737|ref|XP_650398.2| jCVI|EHI_091470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]