SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183234876|ref|XP_648942.2| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183234876|ref|XP_648942.2|
Domain Number 1 Region: 128-168
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000000000176
Family Transcriptional factor domain 0.0035
Further Details:      
 
Domain Number 2 Region: 7-99
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 0.000000000353
Family Elongation factor TFIIS domain 2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|183234876|ref|XP_648942.2|
Sequence length 171
Comment hypothetical protein [Entamoeba histolytica HM-1:IMSS]
Sequence
MSREDATKPAVSGSNSYNTANKTKALKVLSKYIKESDILDGIGEGLAVKYKEDNEKFNFH
LRQILAGLRKNKKLVDNLCSKKVTPNELIEMSPDDMADEAVKEIKERIIKDEEDKKKPID
ISKIPDNNEFKCGKCGSRKIQETLAQTRSADEPMTRFLTCASCGFFWKMSC
Download sequence
Identical sequences A0A175JXC6 C4M9Q6 K2HTH5 M2S1V2 M3UXJ7 N9TCC0
gi|169800868|gb|EAL43551.2| gi|183234876|ref|XP_648942.2| XP_008858221.1.50645 XP_648942.2.49425 jCVI|EHI_055430 294381.C4M9Q6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]