SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193808879|emb|CAQ39582.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193808879|emb|CAQ39582.1|
Domain Number 1 Region: 162-208
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000241
Family Tudor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|193808879|emb|CAQ39582.1|
Sequence length 316
Comment hypothetical protein, conserved in Apicomplexan species [Plasmodium knowlesi strain H]
Sequence
MEEFSETLEGLEGKIVEYEKQLALVREEIKKYEQTTGEEDEQIKNLRKLECDMLEVINLT
LDLINYKKQNEAEGESLGPGLEKEPEDDANEDATREASALIGRTCSFIYESKKVYGLIQN
VVKENDIEQLLINIFENNEQIMIPPKYVLLNEVLTESALAENSQFQALYKKDGLWYDCIV
SKSMGDSFLVNYIGYNTSEYVKNDQVRIKKKKKVKEIVTPAGYKIPENLIVKENDSLKVQ
MRKKKKRIALKKKQKSELINKEYTNKTQQWRSFHEKAISKSKHLLVAHKKVENIEYKNAP
SSFTIRRKFDCHDNEE
Download sequence
Identical sequences A0A1A7VK24 A0A1Y3DM47 B3L3W1
PKH_081680 XP_002258809.1.91479 gi|193808879|emb|CAQ39582.1| gi|221055341|ref|XP_002258809.1| 5850.PKH_081680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]