SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193809265|emb|CAQ39967.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193809265|emb|CAQ39967.1|
Domain Number 1 Region: 32-51,78-155
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.04e-16
Family Splicing factor U2AF subunits 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|193809265|emb|CAQ39967.1|
Domain Number - Region: 151-173
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000173
Family CCCH zinc finger 0.0056
Further Details:      
 
Domain Number - Region: 18-37
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00455
Family CCCH zinc finger 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|193809265|emb|CAQ39967.1|
Sequence length 308
Comment U2 snRNP auxiliary factor, small subunit,putative [Plasmodium knowlesi strain H]
Sequence
MAEHLARIIGTEEDRVNCPFFWKIGACRHGDQCSRSHYKPNSAQTLVIRHMYDNPPMAVA
IAEGQMVEDEVLDKAADHFEEFYEEVFEELMKYGEIEDMVVCDNIGDHIIGNVYIKYTHE
DYAEKAVKELNGRFYAGKPLQIEYTPVTDFREARCRQFVDGQCRRGGYCNFMHIKHVPRS
VKRKLYKRMYKKFPEYKKRRKTKDGSEDGHYDSHRDRGTRDKHRRDKYGDSYHSSRRRNR
SRSRSRNRDDADGDSDGASRRHKYPRRENSAERREKIERWNKEREMKNMQKDDDDEQHAS
QEDPVGNV
Download sequence
Identical sequences A0A1A7VEX1 A0A1Y3DJ06 B3L4Z6
XP_002259194.1.91479 gi|193809265|emb|CAQ39967.1| gi|221056112|ref|XP_002259194.1| PKH_091670 5850.PKH_091670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]