SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193809441|emb|CAQ40143.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193809441|emb|CAQ40143.1|
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.18e-24
Family Staphylococcal nuclease 0.013
Further Details:      
 
Domain Number 2 Region: 639-687,730-818
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 2.48e-16
Family Staphylococcal nuclease 0.0046
Further Details:      
 
Domain Number 3 Region: 863-962
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.29e-16
Family Tudor domain 0.0055
Further Details:      
 
Domain Number 4 Region: 385-470,561-610
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000000000209
Family Staphylococcal nuclease 0.012
Further Details:      
 
Domain Number 5 Region: 914-1064
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000759
Family Staphylococcal nuclease 0.0034
Further Details:      
 
Domain Number 6 Region: 164-187,258-376
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000262
Family Staphylococcal nuclease 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193809441|emb|CAQ40143.1|
Sequence length 1067
Comment hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H]
Sequence
MEKLNGIVKQVVSADTYILAGAKKGGVAQERQVSLACIQCPRLFMKNQNVEKNEEPFAWE
SREFIRKMIIGKNVSFVVEYVYNNRTYCSVSYEDKNLAVLLLQRGYANLVSNKNVKTNVY
AELESFYIEAKEKKLGIFGNNINNHVRNIVYSYNDKNQNKKIYDMFANKNLKCVVEHVRD
GSNFRVYAEMEGTEKREDNMKVGGGTALQNGTVGESNSAEKGKKKKSGGGKKKTQKNNEG
GEGAGSGVDEDGKVAMGYKTMYYFSFTLCGIIVDMFKKEVVNNVENVKEEQYAMETKKFV
EARLLNREIEVVIKHIDNNCNLYGNVFYKLGNICTLLLKNGYAYINEYTIKYVENAIEYK
RALDEAIQLRKKKWINYTEKKVDYEKEYLASVIEVVYGDVIIIDYHNEERRLYMASIKCE
KHSTDLVQNTLCLSAKDYLKNQIAGQVVKIVTEYVRTPQSNSEGYIPQCSDDQGRMHFVS
VYKMDDKKKKNKESAKDVAAVASNKWGGEGEEKKKKKKNTKKGGATTTGEGKSSGMKKGA
KINGNAEANLGEEDVEDDEDNNWINMNEQLVARGLAKVMNHRQEDEKAANYFKLQELEKA
AQEKKVGKYNPHIDIIKINNISGSENSLRARSFENVLNKYNNLNACVDYIYGANKFKLHI
PSQNLLVNFILLGISVQKINLKEIGSINMSASQMKMKKVNGVGEYDEGDAHNMLNGDGKS
TRKEKLELKEIAVQAYKYTRKMLMQRNVQITILTCDKGGNFIGILRHQNKDFGLHLLNLG
YGMLNEIGLSNTNERNNYVKAVEEAKKEKRNIWALEKIDENEEDTDNAMLNGKNNLSQFD
NIYYCSYVEDINNIYIQLKSKQDQLKKLQEELNNQSNLESSSQYALSDVKKNTLVIAKYI
DKCYYRAVILQVNKAKQKALVKYIDFGNEDELNFEDIKKLSDGLSLKNYPPFSIRVSLAG
VKIPIENKADLIIYVKKFLLDKFLYVKFEKKEKNGSYYHVVFYDYEQFTTNKNVKSVNED
IVSSGICYVDNRSDTKIFEKLKKEEVVAKKAKLLIWAYGDIDYDDES
Download sequence
Identical sequences A0A1A7VDM6 A0A1Y3DK43 B3L5H2
PKH_093420 5850.PKH_093420 XP_002259370.1.91479 gi|193809441|emb|CAQ40143.1| gi|221056464|ref|XP_002259370.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]