SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193810722|emb|CAQ42620.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|193810722|emb|CAQ42620.1|
Domain Number - Region: 584-624
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0173
Family DNA repair protein Rad51, N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193810722|emb|CAQ42620.1|
Sequence length 923
Comment hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H]
Sequence
MRLITLGFIFLSTSLHYSHVFALNTNRNLNIKPTSHKSSKNDKANGADNITNKGDSNDAT
TGATGASNGSSNGKEGTATTSATSGQGSPGTPGGTMTPGMNPSLEEMMKPLNEIFAGNGE
GLNIENIMNSESFQNFFNSLMGGNPQDGSSNGQENLFKDMMSAINSQLAGATGGAAGADA
NNGNNGPNIPVSPEQLNKINELKDKLENVLKKSGIDVEQLKKSMENENFMQNKDGFKDFL
ANMPMNPAMMQNIMGGKDGNIFNMDSNQMMDMFNQFSQGNMNMKDFGMGDFMSNGGFPAG
MMTPPVGSQDKGAEDNLMGGKAYVSNSNNNDINFADKLNAFEDINGSDERMFDLYETNDE
DGVTSNSMSDSVEESDILEVNGTNVNRNLSDENSVEEDLDELDANFGSNSSATVSNESSQ
NNRITDEVESNEEELITSSGIKGDANKVTTTNGYKNNNGLFDMNNLKKDNNASSTYGNDN
VGDNSNGGNINEGNNNKVMKKRTGGKKKKTIKKKNPGQIPFKIESLQKLVKEFANTSNQK
IMEDIVKKYVSMNNQSSTSNSDDDDEDEDMEDEKNGKGKSSENEEELSMDEFSVKDIKKL
ISEGVLTYEDLTEDELKKLAKPDDMFYELSPYANEERDLSLNETSGVSNEQLNAFLRKNG
SYHMSYDSKAIDYLKQKKAEKKEEEQEDDNFYDAYKQIKNSYEGIPSNYYHDAPQLIGDN
YVFTSVYDKKKELIDFLKRTHGVTDESDSTSGKDKDNSAENGAYKSKYYDKYMKKLSEYR
RREAYKILKKRRAQEKKLQKKQEMQNNNNNEVDYSEYFKKNGFINSSNGTVKTFSKDQLD
NMVKQFNNGGSEIFSSGGSGADVGGDYSGMGAGGQFSPSSGNSNTTGYVTFDGQSVVGSN
ENEEEESNEDILNEDEDNSEDDD
Download sequence
Identical sequences A0A1A7VP43 A0A1Y3DRJ7 B3LBD0
XP_002260648.1.91479 PKH_131290 gi|193810722|emb|CAQ42620.1| gi|221060006|ref|XP_002260648.1| 5850.PKH_131290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]