SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193810807|emb|CAQ42705.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193810807|emb|CAQ42705.1|
Domain Number 1 Region: 88-226
Classification Level Classification E-value
Superfamily MTH1598-like 1.31e-45
Family MTH1598-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193810807|emb|CAQ42705.1|
Sequence length 226
Comment hypothetical protein, conserved in Apicomplexan species [Plasmodium knowlesi strain H]
Sequence
MKQPSSNEILSLPQRGRRPVGRDSDSSDEVELGNNGEQSEQDSAEETGGSGKSEISVHMD
DRDEASERSVALPYVNKKIKDGQLEKMYQYEYVDHPADVILHSYGKTLKECFESICVSMF
NYMCNLNEVEPKLSRRIAVGGETLEDLLYNFLTECHFLYGSEYIICSSVDILVFDRESFF
IEAYAYGDVFSPDLHECGTEIKAITKHELKICLKEDIWEAFVLVDI
Download sequence
Identical sequences A0A1A7VM25 A0A1Y3DSG5 B3LAA1
XP_002260733.1.91479 gi|193810807|emb|CAQ42705.1| gi|221060176|ref|XP_002260733.1| 5850.PKH_132130 PKH_132130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]