SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209557765|gb|EEA07810.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|209557765|gb|EEA07810.1|
Domain Number - Region: 6-111
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00319
Family PWWP domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|209557765|gb|EEA07810.1|
Sequence length 499
Comment hypothetical protein, conserved [Cryptosporidium muris RN66]
Sequence
MSANELPHNELVWWRMTRKQRYLPGRVVDLKLEDQTVGLEKEHEKILNKLLKPGMIVVNS
FDDMKYAVCNTNNVKLYPAIPEEEQSLLERECIKSSKANYRALLRVKKLLEIRQLEQVKN
INDDIHISPLEVSLIKYFKYRDCMKGISESIYFFETNTAIEILGTVISRKSLKTVIGQSP
QAYSYLERYLKSENCNNNKISLENTDNEDFSNMTLEAREWQNTLNEIVVNRKAISELLSC
IPIEILGCTNINTVPTSNINNPIEWESLVCKAFEEKGKRTQDSIFIIEYIKVSLLYIQVL
ARTVAMRVLNVSYNQKSGTEKKEPYVIVLSLSYLYSNFYDISSTIPTSFIKLRNAEVGPG
DGEHWTKYLYKNHGDSKELPASNSNENSLDMLSFCLKTTSPDTSSTRLFYRVGIDKISSQ
LVLSSELKHAYQIYHNKYRRSDLDERLKALHTIRSSCPTMLKLLNEWLIHRKSGDVPFDH
INSIERIHKIRDILGSVYK
Download sequence
Identical sequences B6AHW9
XP_002142159.1.43237 gi|209557765|gb|EEA07810.1| gi|209881442|ref|XP_002142159.1| gb|CMU_028840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]