SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209878362|ref|XP_002140622.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209878362|ref|XP_002140622.1|
Domain Number 1 Region: 469-512
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000156
Family PHD domain 0.066
Further Details:      
 
Weak hits

Sequence:  gi|209878362|ref|XP_002140622.1|
Domain Number - Region: 156-184,266-346
Classification Level Classification E-value
Superfamily SET domain 0.000916
Family Histone lysine methyltransferases 0.073
Further Details:      
 
Domain Number - Region: 750-788
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0552
Family Tudor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|209878362|ref|XP_002140622.1|
Sequence length 1496
Comment hypothetical protein [Cryptosporidium muris RN66]
Sequence
MEWVTLENVLQDRGIQYAKHQILDKSASKLKKEINLFCKNINSIDDLIDMNHSQYNKNKL
SKRDRIKNFEGNISPHIFSSTLGSIEGVVDINSQRKLHTSILDCIEKGYVSDNIQIVNII
DNSHPVRLATKASSNCYSLIWKGRSLPDSHDVPMVLGEYTGNVVYVGEDDISDESYSFQL
TFKDTAFKYPNSVVTGSIPLLNERIISELNLTYKNNKYQPETCENSNILNASGDVLCYSK
PYSKVEEIKRTNGLVKKLGARLLLPHDNEYIITADNKCNEMAFLNHYECIISNNCNLRIN
TQWHSVYIDGWPHILLTTIPGIGIKNGDELSADFGSCWFSKIKRICKRNIIEEFILYRNK
YFNYSQSIERGCMNKYQHKKDTNLDFIEKTALKDISDSSNKKCPTLDTKTIIEKYDTYCK
PELPYEFCKESGKDICEICQHIVLPKTSKYNLKKFVPKSISYQCFPDIPDNIQSYVVCSG
CNRAYHWQCIQRPELTKLSMMFNRWYCFQCIQLALDILPLLIKCIPGIDLNIIKIINDFF
SGNIFYSGVVDVNNRLILRSSEQVLRENPGTISFRPSENYIVNQRFIEEDTGLKSLSYLK
PCYICYSTIQFSRICSTGIALLCRIYRMHLAPDYDELFNTLQFNQVTDSKSKRNLASISF
INGSSVFQPHCEFSNNSKKSLLNTNTGDQFRVKCITERSRKVINSLRLSLYQSENHRSEL
LLKLESLRSIQDKYFYTITAGNGLIPVICIKLGETVINKIFNGVLYEGVVTRYYPKERLF
HIEYSDGDAEDMEYSDFLYTFYNDIKSGRIPFEKILVPTEVNKNSNFQVTEYNFDEINIG
GTLRNNSEFFGDRLKIDRGISKYNKSSQNTESHILNVSVDNTSDKHTISKCSILDIIDFF
HKVFTKICKLQFLMKGAVRLFEKPCYRYINEPIWCCMEGKYNVKNITATYSIEIITSEIE
RVNLNLSLRSKISFGSIILKRDIPLKLAFEDLGNPYNCTIDLNNGYTCVSSRTRSNKINN
LGNIMECTSESALKWINERIEEICDADELIGANTEINKYESTHETSRNCKGDLKSSTVGT
SDLMTSINNLISEEWIKRCNELAQILEPYPPGIKWLSKKCAWKITYKSEDGERRNSKLQV
YPSSDTNTVEGLYIKACNILLVQSMPFDSFNYINLEEGSKENTYTAIEHTHKDFMSSTKD
LKHSQTIFRSYNFSENKRLLELIREEVDSINPMPKFIIWDEEKLAFKIKFSGHSEQLLFL
SDFDFQVDKCINFAVKHLKYISAIKSSKDEIGGNEDLRPINTVSDIEIEHYKKGISYYSS
FLDKSGVLSKDIDNVCDKLIEDTDKCNDLAKNSYNLLEKKTKLRRTNLKENIPNTQINGE
VVSLKCDKSEYNDMKPIVRASPTPLDPESRARIIEYSKEADLLRPFPHGITWCYRSARFK
VRYRRSTDGGWTATSFPPSKFDSVKTALNFAMRKLAMHIDDYKNSITIPKLPDHLV
Download sequence
Identical sequences B6ADI2
gi|209556228|gb|EEA06273.1| gi|209878362|ref|XP_002140622.1| XP_002140622.1.43237 gb|CMU_007630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]