SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209878945|ref|XP_002140913.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209878945|ref|XP_002140913.1|
Domain Number 1 Region: 176-226
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000211
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|209878945|ref|XP_002140913.1|
Sequence length 317
Comment hypothetical protein [Cryptosporidium muris RN66]
Sequence
MNELDESLDSLEEKRNYHIEQLKLVEDQLTISDNENNNILMKLRDDLIEIINLTNDLIKY
KSSVELNKSTNISAIVPTNNENTNEVAKTEIHSNLPLTKSIKLEDSFNHILPSIIDVNGK
SFNIGRTVELNSTDNYRKYAKIESESGTGYKVCLFGSNKTIEISKGKVHLLPELTNLKKD
DDAEALYSYDGCWYACKIKDVRQNGYLIEYSGYEEDDIIPFDRIRIPRRSDKVLDNESKI
PNIITPAGYKVPENLIIKPTDSEKVKFDKRRKMSAIKKQQRSDFIESRAIKRQDSWKKHI
NSVNKVPIFNKILSNYK
Download sequence
Identical sequences B6AEE7
gi|209556519|gb|EEA06564.1| gi|209878945|ref|XP_002140913.1| XP_002140913.1.43237 gb|CMU_012380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]