SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209879814|ref|XP_002141347.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209879814|ref|XP_002141347.1|
Domain Number 1 Region: 67-112
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000033
Family DNA repair protein Rad51, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|209879814|ref|XP_002141347.1|
Sequence length 189
Comment hypothetical protein [Cryptosporidium muris RN66]
Sequence
MENRIEVRKAALEKISERLLQEFDESEPENIPYFIVDFLCKNYGDYLCGFAKIWNGEFDF
EQERLAVIDFFRSQLINMQVTADFISAGYDTLESLCTVTPDDLANIEKFSESSWLPGHKI
RLQQIFSDIVSRVQQWRDERERALQKPCQHQCTTRMVNMSGTTPKLPVLTGNPSTSYCMS
SLSQSIPRY
Download sequence
Identical sequences B6AFK7
XP_002141347.1.43237 gi|209556953|gb|EEA06998.1| gi|209879814|ref|XP_002141347.1| gb|CMU_033830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]