SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209880758|ref|XP_002141818.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209880758|ref|XP_002141818.1|
Domain Number 1 Region: 496-556
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000014
Family PHD domain 0.0094
Further Details:      
 
Weak hits

Sequence:  gi|209880758|ref|XP_002141818.1|
Domain Number - Region: 562-621
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00343
Family PWWP domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|209880758|ref|XP_002141818.1|
Sequence length 721
Comment hypothetical protein [Cryptosporidium muris RN66]
Sequence
MQISEIINNSGPTSLGEGEKLDEVNGILDQDFVRKFALVVNMLQSSQPTNSDNLVSQSQI
VNDTDKDNLHFSQCNKFWNTNSHIGDSVNNKIDFLSQECSAIDSSTSQMSICDTSRPLKM
SFNALKDKMSQEKCPKKKSKLDEEGTHWQEGEVLTKKNRQKIHCYYAFTPSKTNLRVRCG
ECSNVFNGVRGLISHSRKCGKTNKDSLSQELQANIIPSQLKAITEISTTQYEKTSHNFNY
NDSLVANSSFSTQTTDLSQSNPSVPCTISSRTSSVEHNFMASFSSGFTSKLLNSDLNQVV
NDKCDVPNSIKNANIDSNEVTEICEMSKTGNNNSKFTINEDNLRQKNDRFGVREFGECSP
EKFKRHIYSAISCLPKSILLKILIKRNPIAYQSLRDKMYSITRESIIELISSEFSLSSRN
LYTDTNSTLETSEENRTVQDREEQEQEQEQEQEQEQEQEQEQKQKQKQKQKQKRSQIDSS
ISDDLDILDFPNIPVFFRHLLPTLTEWKCNICKEVGEPTDSMVMCEGCGLIYHFNCHNKS
NSVVDNDWICEWCQKENMSLYFNSRYQIGELVWTIYKSHRWPAQITEIYNKGKKFVVQIF
HIQKVLERKPEDLLSWTLGITYIEGNAARGAFLKDSNSANLYWQSIIKAFQYYIYSLKVS
ERRSVPNIFYANEVHKSSSNKSVPIEDEASASKTIQHPVLVEISNERNNSLDLDYHLDKS
V
Download sequence
Identical sequences B6AGX8
XP_002141818.1.43237 gb|CMU_036430 gi|209557424|gb|EEA07469.1| gi|209880758|ref|XP_002141818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]