SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|211966482|gb|EEB01678.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|211966482|gb|EEB01678.1|
Domain Number - Region: 87-129
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00146
Family NusA extra C-terminal domains 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|211966482|gb|EEB01678.1|
Sequence length 230
Comment hypothetical protein, conserved [Toxoplasma gondii ME49]
Sequence
MSDRTGTDEAKPKGSAGKPVGGPSKVHAQVQQLFARMQQEIEDEKPANVIFFIVDFLCKH
YPEHLSGFAAIWNADPDLEKERQGVVEFFRAQKLPTEIAAHFTNAGFDTLETLCTLTSES
LDDIEKFNQVRWLPGHKVRLQQTFADIAGRVRTFTEDKENLVRAMRASMYCQHSQLMNKP
NFVPSHPVTVIQGSSPSASPPCYFAPQSSSPLTLPASTTHRSNLYSPVYQ
Download sequence
Identical sequences A0A086JC65 A0A086K3A2 A0A086KEW0 A0A086LQK9 A0A086PMZ2 A0A086QMA4 A0A125YWB9 A0A125YWC0 A0A139Y3I1 A0A151H6H1 A0A2G8Y4D3 B6KLE4
gi|211966482|gb|EEB01678.1| gi|237839041|ref|XP_002368818.1| gb|TGVEG_109010 XP_002368818.1.89292 gb|TGME49_067500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]