SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221057107|ref|XP_002259691.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221057107|ref|XP_002259691.1|
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000732
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  gi|221057107|ref|XP_002259691.1|
Domain Number - Region: 77-202
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.051
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221057107|ref|XP_002259691.1|
Sequence length 260
Comment CDK-activating kinase assembly factor [Plasmodium knowlesi strain H]
Sequence
MDEYKCSSCLEDVCTRSEKKLFYFDICKHKICGECLENHLSQHNKQHCPRCKMSVTKKNV
TPFDIEERIYSNQKNIRSKLTEIFNKRRHNFESTPLYNNYLEQIEDIIYLLTNEADEKKR
KIIEAYIKKYEKENQKIIEENNVIIYENEKKKIHDIVKKEGNFYEIIKHRPLIKKPQNET
FIHSLVRENPKLFDEIKVTNITECQPQPLNPAIKNDTDIPLRRFSSEDELKKSDHAGGYD
ISIVFKRCDTEFNSTIYLNI
Download sequence
Identical sequences A0A1A7VIA7 A0A1Y3DV88 B3L6E3
XP_002259691.1.91479 PKH_102030 5850.PKH_102030 gi|193809763|emb|CAQ40465.1| gi|221057107|ref|XP_002259691.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]