SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221061959|ref|XP_002262549.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221061959|ref|XP_002262549.1|
Domain Number 1 Region: 565-655
Classification Level Classification E-value
Superfamily HemD-like 0.0000824
Family HemD-like 0.035
Further Details:      
 
Weak hits

Sequence:  gi|221061959|ref|XP_002262549.1|
Domain Number - Region: 166-210
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000392
Family DNA repair protein Rad51, N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221061959|ref|XP_002262549.1|
Sequence length 715
Comment hypothetical protein, conserved in Apicomplexan species [Plasmodium knowlesi strain H]
Sequence
MNQLYCLHRQMNEKMRKIENPQKDPCHNTVIRPPLKNAQGVEDKRGNVAFLVSMKNKDIQ
EKSVDGEKITDHSEHSQGEVAVPSRDEREKYNELFDAKMYLPPLRANKRELNFFFKILSN
AMEKNNNSNIYISLMNILCKNFPSYIGLFAHLWFQCKVLLAEKLILIEFFRQLKINSEII
NHFFNYGYDSFETILSITPQELKNIQEFNKVTWLPGHTFRLKMIFSKIEKYFNLFIQQND
DYVQKIKKFILNRRKKTELTVQLSLEWQQNDRSECKMYKSQVGSNTNPQVLPQWAHDDNI
NTYQRYMSQIWRNKIFSYNSTPDNSLYANRTPNSDSPGKPFCLNKFENYEQFRKKSSPLS
PNLKCVQGAGANTTRASPRADKAKVSILITSPEGAKIYRFITILLIYNLVKRKSEEKSPL
GRSINVDDNDAVNDVLSIPIISIGKSCNAVLNNDGTRSDLCDMFQNVVKEFPKCIINQND
FHQLNKTVKSLNIVFTPSKANSVTLHRELTANFEKHKKEGTLNTENIIWVASSISKSNFH
DKKSEFTPFGRKDEDEEEEERSGHLTVTRINCYDTKKVTYKKNEMEIERKSIICLMSNST
VVSFFQNFGNNFAATLCMGRNSYMLAKKLNFKHVLYPEDSKMESFLIMLIKLYNELRDKF
GTQYDVVLTREKGKNDYLVRALTAERIPYRVVPCIRTHYHGEGIRLLYSILSSNV
Download sequence
Identical sequences B3LDB8
gi|193811699|emb|CAQ42427.1| gi|221061959|ref|XP_002262549.1| XP_002262549.1.91479 PKH_146500 5850.PKH_146500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]