SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23494999|gb|AAN35332.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23494999|gb|AAN35332.1|
Domain Number 1 Region: 46-147
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000585
Family Thioltransferase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23494999|gb|AAN35332.1|
Sequence length 191
Comment conserved Plasmodium protein [Plasmodium falciparum 3D7]
Sequence
MFLLCLLLWRNIICDIKELNYEQFYKMLTTEKNNQKKNYILDKSINYKNFKSFQDFLYIK
TNEDFVLYVYAKWDTDSNNLISIFREVDRILTEHQIKLNFYIFNIDQAKDLCNFLNITSL
PLILYVSSVHKKKYNTLLYKFLNSNKDIKISNAFRYNGDMYCYDYIVEWVEAHYYFTKFV
LLMKKLFSWKK
Download sequence
Identical sequences A0A024W8I7 A0A024WPF5 A0A024X9E4 Q8IJQ8 W4II29 W7F0Q0 W7JXU6 W7K6C0
PF10_0134 XP_001347419.1.26446 5833.PF10_0134-1 gi|124802252|ref|XP_001347419.1| gi|23494999|gb|AAN35332.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]