SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23496300|gb|AAN35958.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23496300|gb|AAN35958.1|
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 5.36e-22
Family Staphylococcal nuclease 0.016
Further Details:      
 
Domain Number 2 Region: 899-994
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.63e-16
Family Tudor domain 0.0085
Further Details:      
 
Domain Number 3 Region: 681-729,771-856
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000000876
Family Staphylococcal nuclease 0.0052
Further Details:      
 
Domain Number 4 Region: 405-491,599-652
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000000209
Family Staphylococcal nuclease 0.0098
Further Details:      
 
Domain Number 5 Region: 307-397
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000000432
Family Staphylococcal nuclease 0.014
Further Details:      
 
Domain Number 6 Region: 946-1095
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000109
Family Staphylococcal nuclease 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23496300|gb|AAN35958.1|
Sequence length 1098
Comment tudor staphylococcal nuclease [Plasmodium falciparum 3D7]
Sequence
MERLNGIVKQVISADTYVLIGAKKGGVSQERQINLACLQCPRLFMKSQNTEKVEEPLAWE
SREFIRKMIIGKNVSFCLEYTYNNRQFCSVFYEEQNLGILLLEKGYATLVSNKNVKSSVY
ADLEPYYVQAKERKVGIFGNNIKSYVRNIVYCYNDKNENKKVYDLFVNRRLKCVVEHIRD
GANFRVYAEKEAANEKREVLVSTNNNNNNNNNNNSGEKNKKNKKNKNNNNNNNIDNTELN
GMIEEDTGNSKKKMKNKNKKKTNEDENAESNLNPNEKYLTMYYFSFSLCGIIVDMFKKEM
VDNEETVKEELYAMETKRFVESRLLNRDIEIEIKHIDNNFNLYANIYYKLGNICTLLLKS
GYAYINEYTIKFVPNPIEYKKALDEAIQLRKKKWTNYTEKEIDYEKEYFSRVIEVLYGDV
IIIDYKNEERRLYLASIKCEKHNNTDIKLNTLCLMAKDCLKSQIAGEQIKIVTEYVKTPQ
SNSDGYIPQCSDDKGRMHFVSIYKIQKKKNKNDKNKNHINDDVYDGLTNKWNEKKNTKGN
TKRTLAHNNNNNNNNSNNSTSKLNNISKKKNVKKNSKKLNTPLGNNEKGLDYDDTDDDDD
EEEEYINLNEELVAKGLAKVLNHRQDDDKASNYFRLQELEKEAEEKKLGRFNPHLEIIKI
NNISGNENALRARSFENTLNKYNNLNAYVDFIYGANKYKLYIPSQNLLINFILLGITVEK
INLKDLNNMELKIKNKNNMNGMENNEKNNILNGDADFEKNNSKKEKLEYKEIAVQAYKYT
RKMLMQRMVQISIITCDKGGNFIGLLKYQNKDFSMHLLSLGYGVLNEVGLNNTSERNNFV
KAAEEAKIQKKNIWSLEKSEYTDNLLKTENDLTAYDNIYYCSYVEDINNISLQLKNRKEE
LLTLQRELNKKSNLDSSNLNEINKNTLVLAKYNDNCYYRAIVLQVNKNKKKVLVKYIDFG
NEYELDFVDIKKLNEQFNLKNYPPFSFKVSLAGLKIPTENKTDLIIYIKKFLLDKFLYVK
FEKKEANLFHVVFYDYEQFNTNKNIKSVNEEIVYNGICYVDNNSDTKIFEKLKKEEILAK
KNKHVIWSYGDIDYDDEN
Download sequence
Identical sequences Q8II01 W7K382
gi|124804579|ref|XP_001348045.1| gi|23496300|gb|AAN35958.1| PF11_0374 5833.PF11_0374-1 XP_001348045.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]