SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23496990|gb|AAN36541.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23496990|gb|AAN36541.1|
Domain Number 1 Region: 702-792
Classification Level Classification E-value
Superfamily HemD-like 0.0000000942
Family HemD-like 0.02
Further Details:      
 
Weak hits

Sequence:  gi|23496990|gb|AAN36541.1|
Domain Number - Region: 200-245
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0471
Family DNA repair protein Rad51, N-terminal domain 0.058
Further Details:      
 
Domain Number - Region: 806-852
Classification Level Classification E-value
Superfamily HemD-like 0.0602
Family HemD-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23496990|gb|AAN36541.1|
Sequence length 872
Comment conserved Plasmodium protein [Plasmodium falciparum 3D7]
Sequence
MIHEYRPHTVLRVIEDNKKFIYKKEHVDQDNNNNKFDNDTKIKEIYKRQNDCHYNDYPKY
IEENKYKSDKEYTNKNKRDIYIYNEKDNFEYIKNKEDLNNINKKKKGKCDCEILCLKKRE
QNDYNNFFNSTKYIPTLKANKNELRYFFHIIKNMMKKNIHNNDNIYILLINFLCKNFPSY
IGLFAHLWFECKILLAEKLIIVEFFRQLKINSEIIYHFFNCGYDSFEILLSISPHDLINI
QKFNNVTWIPGHSFRLKMIFSNIKHYFKIFIQQNDDYIKKIKNYILQKRKKKTKHINNSK
FMKHYNNNNKKDSTNLKLPIHTFLSMQALHDMDINKTNINDPLSSNVKYLKFKPHDLVHQ
NQSIITDYHSCTQFFNSLMKCSLLLNFLILLLYTFFNSFLSIKFMTNYKDNFSNISNIKK
NNYNILKFFYILPEQVRKKYISYFILSCSDKENIKRRGKRIKKDNMEYNKYDIKEDVKKN
DMCDITNDDDVISNKNHFINKSNSKLYILITSPEAARIYRYIVILLIHNLKNTNLKYETC
NERKLNYIKKFVKDISILSIGHSCNDILKNKFNKSLFYNISNKNSSIHKSPIFKIKKKKL
LQINRDISTHLNIVFTPTKANGNTFKKELRDFFFLKKNEQRNNNIYKKDKQKRNVNINQH
EYINEQKNLHNNILWISSSISTSSFDDLDIHPQNNNHIYDRINLKRINCYDTQQVTYNIN
DKTNKIHITKYSIICLMSTSTVLSFYKNFGNNFSYVVCMGKSSYELLKKLNFKNIYFPEN
SKTKTLLNILITLYHKLNNKYKRKFHIILTRQKDKNEEIKKVLSQQNIDIQEIPCIKTKY
NFANISKLYKLLYSYINQACTQRKRTKMIKYI
Download sequence
Identical sequences A0A024WM03 Q8I4V6 W7F8H4
PFL2285c XP_001350861.1.26446 5833.PFL2285c-1 gi|124806901|ref|XP_001350861.1| gi|23496990|gb|AAN36541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]