SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23504975|emb|CAD51758.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|23504975|emb|CAD51758.1|
Domain Number - Region: 62-110
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000196
Family NusA extra C-terminal domains 0.036
Further Details:      
 
Domain Number - Region: 11-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0126
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|23504975|emb|CAD51758.1|
Sequence length 165
Comment conserved Plasmodium protein, unknown function [Plasmodium falciparum 3D7]
Sequence
MSPKNYSRRAVSKLLNCLSEEIEKQQPKNVIHFMVDFLCKNYGSHLRGFAHVWDVDIELE
KEKKLVIEFFKSQKLTTEIAKHFINVGFDSMESLLYLNVHILDDIEKFNKVNWLPGHKIR
LQQMFSNIDENVKKFYMEYEEGAKNNMDYNCIRVNERNGEIDDTY
Download sequence
Identical sequences A0A024W8L0
PFI0360c XP_001351947.1.26446 gi|124506699|ref|XP_001351947.1| gi|23504975|emb|CAD51758.1| 5833.PFI0360c-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]