SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|237830829|ref|XP_002364712.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|237830829|ref|XP_002364712.1|
Domain Number - Region: 6-103
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.00183
Family Major surface antigen p30, SAG1 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|237830829|ref|XP_002364712.1|
Sequence length 137
Comment hypothetical protein TGME49_115330 [Toxoplasma gondii ME49]
Sequence
MELEITNESKIASFQCDTGIDNLTPESATEIFDEYCHKSLKLSEELPSAKLETENGRRTF
SVEHLPENAATYCYKCSSPGVYDKKELPSQNSNACTVKIKVSAANVGSAAVTSATTGVAS
PLVLGSAISLFFFLSIL
Download sequence
Identical sequences A0A086JXK3 A0A125YI91 A0A139XN11 A0A151H8L6 A0A2G8Y0I4 B6K9I8
gb|TGME49_115330 XP_002364712.1.89292 gb|TGVEG_100440 gi|211962376|gb|EEA97571.1| gi|237830829|ref|XP_002364712.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]