SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|237833909|ref|XP_002366252.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237833909|ref|XP_002366252.1|
Domain Number 1 Region: 358-466
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000385
Family PWWP domain 0.0091
Further Details:      
 
Weak hits

Sequence:  gi|237833909|ref|XP_002366252.1|
Domain Number - Region: 1826-1851
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00392
Family CCCH zinc finger 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|237833909|ref|XP_002366252.1|
Sequence length 2114
Comment PWWP domain-containing protein [Toxoplasma gondii ME49]
Sequence
MDGGPGGLPHGGGYPPGFPGYGPPLPGMQEAMFHAHQQAAYWHAFSPLLGNASGIPACSY
GAAGSSALPMPFASAAAFQYGAPSAGLHSDKQMDASFQTQGQASTAYDSAASSASLVSCH
APCESVEANAGAPPTGTYAPFSGNSFPEKAAPQRASVAEPLSTTSSSSSSSAASAPASSS
TRHTTPATPATPPPLSRSSLSSTENPAVGKTSAAASGRSSSGGAGQSSRSPNSRPVDSNA
AVPEKLTCAASSPSSPSNAHAAAASRLAPLPYTPEPPSQVDLPDTGVSSGTASSLSCAAS
PESQEGTPAAKMHAEKAKGPGGLRRVRVPQLRFRKKAANDAFFLKTFSKVSGKRGEPLVW
CKRRGRPWWPGLLANPDDPHLVPPLPERVRAKQPSSDKDGEIRLLFLCCGTWRYWWASSK
GVRDFREGYADLAPRVRGLGFLPRLAVQHALEECGWRDNVDWCPSKTIVAAAQAEEVEDE
DGEGWLTENACSSDSEEEDDGFMDNDWWEGRKIPTAAGNPSEPEEASKAFVERAASSRRS
ARVEEVHPDARERQATPQTEGPQEGTGKASPSSLTSASLQGIASEAPPGLPDAEAAWTGE
GERPEGRRGVKKKDSGREFFPGDEMLFERDRKKARETESGQKPDKNVSGPVRDPEACRSI
RLGAARGLVLAPASSPATEEAGPKTSSSLTTSAFVKGSQNVSSRHVETSSVRSSASRFDE
SHVESNARLQSPRRPAHASHPPFVSEDECESKKMSPMCVDSPEREMFLGQTAEVAELSKA
GSVSAFVLDASGSSAEPSPPSLSYPGDLANSEVSSVTPCPADIPRPSSSPFSMSFSGRSK
GTSQSRAGPAVEPPKLPDPPTAAVAVGDSPAPTSAGAASGAVSGPLGRAEGGASDETGAK
KNASGVSLGASTATAERSADASSASVTPAAQAPQSWPETIWHRLRRQAEAAKKERPQSPA
LPRSFAASTPVGQARPAESAQETPAIPTYGAVIAFGQEKPAGLKETLHPPHIRAAAAAGA
AAAAMAAAAAASAAAEKTQRQEALSLQASQALPETAVGAKTAARLETAVGSGTGVGSGPE
NRIPEEVAKAAAAAAVAAAVQVTVGVLGHGKKGDEKKKVPGGGHRGRESETLPKGGRSPR
ESEDSEAGKRRRASRRRGSSSSWDEDSRAEGSCRRGRGSSRSVSVSSPFLLSQRHRSRPR
RDCTLGSRRALKHSRGRRRGSSGSSSVHSVLRASSSLSSAPSRLKWRRRRERPRRSPSRS
RSTSSRGDRRRHRERHVGSPEKRGYLKRWSSRESSCRSTDGVRRGEDGKKKEGRRGNRRR
ENKRREDREEGGSSRCSASSGCSAKFRDGSSGSWRRVDRGRGWHSPWRERGDRRDDWGHK
SARFSRSSSSSSAGLKLAAGRREADSPDSSRHEEGPLASGRRWARRGRTRREEASRKRCS
DGREGMNSSLERSPDPLSPSSRRALGRPDERKETVAMGPTLNSETATTPPPTQSLSPPVP
SVCSASAPLHGEGTSSFLPASGSCTSNEASVCVTAALPERDAKTFQATSAPSSGTPLSSS
FSPCVSAAAVSSLNAAPQSGPGVWPESALEAAGGVETREAERRPLSSLSETGLPSSPAPI
SALPRPPCHLFVSASTASPSQSSSAAPNSSARDASAPRDGRPPGLSVSEGGDARSKHRFS
RGFPSSKSVSASPLSRSSRSPSYLSSSSPSRERWTRGRSHASKHRRRRLRSRCSRRSRSP
SGSPLCEQSRDRESMGSQTPERRSRGREARERRGTFPRRGYRRGSSSEFSGSSRRSPSRS
QRESESSYLSFAARRVRMLHAQGRCLPCRFHWRRGCRNGDGCKFCHDSSHDRFMLGREPE
RGSSRSASMGGSRENGGPEGGLSVSLENRVEAGEGPWGFLGEDGVRGRGLRRFRRSSFGF
SRPFLPRGDGAFREETRPCQAWREKRPRAIGNSLEREGGRSAETDVKRGSCVERDERWME
GDQCSLESNPEEGNRVERAPKRSKETDEGSGHQTEEPGQAIPAGEKALDLTVTEGGEKNE
GGEEGGRASVDDQQTPGGIGLGDNVDIFHVPCPLEEMTFGGSWNSADAPAGVQAEVGGLK
GASEAGTDGQKVHA
Download sequence
Identical sequences A0A086KM13 S8EXH4
gi|211963916|gb|EEA99111.1| gi|237833909|ref|XP_002366252.1| gb|TGME49_025890 XP_002366252.1.89292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]