SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|237843305|ref|XP_002370950.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237843305|ref|XP_002370950.1|
Domain Number 1 Region: 111-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.88e-55
Family RecA protein-like (ATPase-domain) 0.000000118
Further Details:      
 
Domain Number 2 Region: 27-90
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000000000000157
Family DNA repair protein Rad51, N-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|237843305|ref|XP_002370950.1|
Sequence length 349
Comment meiotic recombination protein DMC1-like protein, putative [Toxoplasma gondii ME49]
Sequence
MAALTESKSARKHISSTPHLDVSADDANDTFQSIDKLQAAGINAADINKLKQAGYCTVLS
IVQTTKKELCLVKGISEAKVEKIVEAAAKLGMCNAFITGVELVQKRGRVIKITTGSDQLD
QLLGGGFETMSITELFGENRCGKTQLCHTVCVTAQLPRDMKGGCGKVCYIDTEGTFRPEK
IQGIAERFGLDGDGVLDNIMYARAFTTEHMHQLLTLAAAKMCEERFSVLIVDSIIALFRV
DFSGRGELADRQQKLNRMLSIMMKLAEQYNLAVMLTNQVMSDPGGGLTFTANPTKPVGGH
VLGHASTTRLSMRKGKGDQRIVKVYDAPNLPESECIIQLSSRGIIDVIE
Download sequence
Identical sequences A0A086JHL8 A0A086JK45 A0A086K977 A0A086LP47 A0A086PLD1 A0A086Q277 A0A125YFK1 A0A125YFK2 A0A139XKB4 A0A151H4U0 A0A2G8XNM6 B9Q0H2
gb|TGME49_016400 XP_002370950.1.89292 gb|TGVEG_037900 gi|211968614|gb|EEB03810.1| gi|237843305|ref|XP_002370950.1| gb|TGGT1_098850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]