SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|254832727|gb|AAN36052.2| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254832727|gb|AAN36052.2|
Domain Number 1 Region: 27-121
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000885
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|254832727|gb|AAN36052.2|
Sequence length 175
Comment conserved Plasmodium protein [Plasmodium falciparum 3D7]
Sequence
MKCLIFCFSIFLLLTLSLCSTHKEQKYCNSTHRGILKYHKKKDNNEYVTVSAILKNNALE
LFKGSKFFEKFSLYDIITPIVILSTDVECLTLNFVNDDSVILCCDTEESINNWWLYLTKQ
ILCLHKGELRNENDNKTLEEEQNNIINNNNLNEVSINITEDDLDNIPNVLIKTES
Download sequence
Identical sequences A0A024W456 A0A024WIM9 A0A0L7M3H4 A0A2I0C0N8 Q8IHQ7 W4IGM4 W7F5B3
XP_001348139.2.26446 PF11_0472 PFDG_03232T0 gi|254832727|gb|AAN36052.2| gi|258597426|ref|XP_001348139.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]