SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258597225|ref|XP_001347762.2| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258597225|ref|XP_001347762.2|
Domain Number 1 Region: 111-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.4e-59
Family RecA protein-like (ATPase-domain) 0.0000000226
Further Details:      
 
Domain Number 2 Region: 41-96
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000628
Family DNA repair protein Rad51, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258597225|ref|XP_001347762.2|
Sequence length 350
Comment Rad51 homolog [Plasmodium falciparum 3D7]
Sequence
MKQANTKEDKSQKISNSSTIDEIEEEQLYTGPLKIEQLLAKGFVKRDLELLKEGGLQTVE
CVAYAPMRTLCAIKGISEQKAEKLKKACKELCNSGFCNAIDYHDARQNLIKFTTGSKQLD
ALLKGGIETGGITELFGEFRTGKSQLCHTLAITCQLPIEQSGGEGKCLWIDTEGTFRPER
IVAIAKRYGLHPTDCLNNIAYAKAYNCDHQTELLIDASAMMADARFALLIVDSATALYRS
EYIGRGELANRQSHLCRFLRGLQRIADIYGVAVIITNQVVAKVDAMSMFGGHEKIPIGGN
IIAHASQTRLYLRKGRGESRICKIYDSPVLPEGEAVFAITEGGIADYEEK
Download sequence
Identical sequences A0A024V5V8 A0A024VPW5 A0A024WQ64 A0A024X830 A0A060RZE7 A0A151LIC4 A0A2I0C0M1 Q8I9U4 Q8IIS8 W4IF21 W7EZW2 W7FTM5
XP_001347762.2.26446 XP_018640995.1.24268 PF11_0087 gi|254832605|gb|AAN35675.2| gi|258597225|ref|XP_001347762.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]