SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296005023|ref|XP_001349356.2| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296005023|ref|XP_001349356.2|
Domain Number 1 Region: 109-345
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-53
Family RecA protein-like (ATPase-domain) 0.00000014
Further Details:      
 
Domain Number 2 Region: 26-88
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000000000091
Family DNA repair protein Rad51, N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296005023|ref|XP_001349356.2|
Sequence length 347
Comment meiotic recombination protein dmc1-like protein [Plasmodium falciparum 3D7]
Sequence
MATLPASKSASKVALTSEVEDEGIKEHTFQEIEKLQDLGINAADINKLKGSGYCTILSLI
QTTKKELCNVKGISEAKVDKILEVASKIENCSSFITANELVQKRSKVLKITTGSTVFDQT
LGGGIESMCITELFGENRCGKTQVCHTLAVTAQLPKSLNGGNGKVCYIDTEGTFRPEKVC
KIAERYGLDGEAVLDNILYARAFTHEHLYQLLAISAAKMCEEPFALLVVDSIISLFRVDF
SGRGELSERQQKLNKTMSILSKLSEQFNIAILITNQVMSDPGATMTFIANPMKPVGGHVI
GHASTIRLSLRKGKGDQRVCKVYDAPNLPEVECIFQLSDKGVIDATD
Download sequence
Identical sequences A0A2I0BWS2 Q8IB05 Q967Y1
MAL8P1.76 GO.78826 GO.91447 XP_001349356.2.26446 gi|225632246|emb|CAD51205.2| gi|296005023|ref|XP_001349356.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]