SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46226711|gb|EAK87690.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46226711|gb|EAK87690.1|
Domain Number 1 Region: 146-197
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000536
Family Tudor domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|46226711|gb|EAK87690.1|
Domain Number - Region: 9-61
Classification Level Classification E-value
Superfamily STAT 0.0902
Family STAT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46226711|gb|EAK87690.1|
Sequence length 285
Comment 30 kDa splicing factor, SPF 30, tudor domain containing protein [Cryptosporidium parvum Iowa II]
Sequence
MTRVNSKLMEIFQETYEELLKRFEDNQEQLRKIDEQLLKLTTDDPNYDILKEVRDDLIQV
IQLVEELIDNKRKNSDENPEDVNIGKIVEVFYKGNKRFGRIKSKDPKSASNTINDYYLIS
IFGQIPETISLQFQDLKLLPQFKGLSVGEKVQVLFEEDGNWYNSVIVGLTKNGYNIKYLD
YNQEENVTYDRVRMISKSSRNNLNHDKTIDSLDSTSIITTPAGYKIPENLLIKSYDTEKT
KLEKKKKISVIKKQQKNEIFETQAKQKQQSWKNHISKFQKNSKII
Download sequence
Identical sequences Q5CQL3
XP_625635.1.25317 5807.cgd4_270 gb|cgd4_270 gi|46226711|gb|EAK87690.1| gi|66356914|ref|XP_625635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]