SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56474246|gb|EAL51626.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56474246|gb|EAL51626.1|
Domain Number 1 Region: 23-152
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000000301
Family Staphylococcal nuclease 0.013
Further Details:      
 
Domain Number 2 Region: 178-311
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000000889
Family Staphylococcal nuclease 0.0074
Further Details:      
 
Domain Number 3 Region: 780-837
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000196
Family Staphylococcal nuclease 0.0071
Further Details:      
 
Domain Number 4 Region: 660-747
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000011
Family Tudor domain 0.013
Further Details:      
 
Domain Number 5 Region: 485-593
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000144
Family Staphylococcal nuclease 0.016
Further Details:      
 
Domain Number 6 Region: 351-450
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000017
Family Staphylococcal nuclease 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56474246|gb|EAL51626.1|
Sequence length 843
Comment hypothetical protein, conserved [Entamoeba histolytica HM-1:IMSS]
Sequence
MPAQANKKGVSKKGDASDKKVFMNAIVTGITEKNGLLLATKKEEEKNPVIVIAYLELPRY
DKKQNKEETFAYECGELLRKKLINGKEVKFEVVSEATENVPKMVIPFVNGENIAITLLEN
GYAVLKGKGKEIAEYIKAEEKAKKEKKGVHNENAEKISIKKPIDPKLTSKELDFYVMKNL
NGHIKKVDAPGQFIIETPERKIVRVSLFGINQHATFNVEKKQFEFDDIAKEAIKFNNKNY
NQRDCVVKVMDNGKRVTGIITVDKKDIAEELLKNGYVTISTFEENMESVKQVYEECEAVA
KKERKGRFVNFDQAAEDAAKAKKEKREKDLKERKKNARVIRGGNILFIGKYLRIEKDGEV
LNVNFASIKPLYKKDDKAFNELIEFRMREVIRKLIVGKKFECKEAYKSENKKGEETVTEV
YYDVYADKTNIAIPLLKEGLVVVDERTKDQFYQSFDYSKLKAVPKKTYKPVPITNYSNLD
NVKDMLIGNNFKCVIEKAISLTVYLVYIPEKNSQLIVHLQNCFVPKDDSNDSLKKFVESA
KTNVKQLCEYREVVVDFKRYHKGNLYVEIISNGTDLASYILEHGFAIPTGRYNVSSEIEQ
MKENMTQIYQFDTQKKKEVTEVIEKKPKRNTEIKFSAEQKVYLTGFDGEKIGYYDNAEDA
KIIEEVNAMCKTVKKGAIKPAVGDKCIVENKGFFYRAEFVEVATGANVLKCIDTGAVIIC
GKNKLKPITEEIAGKPVTVKTVGLVGLKTLTPKDVDFAAAVEAVAAYYKKEGSLFVSGEE
AKVVVGDVCINNHLVQLGLAFVDKHFHDNSEWGVDLVAAQLQAKENHLNVWRYGEVADEE
EKN
Download sequence
Identical sequences A0A175JWI4 C4M8B5 M3UU50 N9TIW9
294381.C4M8B5 gi|56474246|gb|EAL51626.1| gi|67483584|ref|XP_657012.1| XP_657012.1.49425 jCVI|EHI_101240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]