SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56474527|gb|EAL51892.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56474527|gb|EAL51892.1|
Domain Number 1 Region: 81-217
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.22e-23
Family PWWP domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56474527|gb|EAL51892.1|
Sequence length 335
Comment hypothetical protein EHI_094010 [Entamoeba histolytica HM-1:IMSS]
Sequence
MEEEKQVDTTTVQSSTPPMSPQHSHSITPSASPKENKVSTPLSPNKEDGSVATPTSRKKE
EETKPKKSPNDSVTVIDKEIEQNKWDNWTVVWVKQKGYPWWPAKIIIMDKLNEKTKGQLE
KLIEFKKDKKYLVKYITNGYQFGWVNDNQIKPFKEEFMNIITERMLGKKDVIESINKAIE
ITNDKISENDIDKFHKAVIKKEKQMEEEEKKKEKMRNCDIGFMVVNDPLIEITKIEGIVE
KSIENNNSSLQKLKNWKEMDHSQVIEELNTLMKEPIMIHEIINPINKIGELLNSICQSTN
IEISVLAERVLERIKKELKYAIISGEYQRCKEIFN
Download sequence
Identical sequences A0A175JJJ0 C4LYJ2 M3UZS9 M7W3R8 N9TPU7
XP_657269.1.49425 gi|56474527|gb|EAL51892.1| gi|67484098|ref|XP_657269.1| jCVI|EHI_094010 294381.C4LYJ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]